PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010911499.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 192aa    MW: 21629.5 Da    PI: 5.0001
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010911499.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM115.55.3e-3641211128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF P+deelvv++L +k++  +++  ++i+++++ +v+PwdL+ k+ ++ ++wyfFs+r +        nr+  +g W   g d++++s 
  XP_010911499.1   4 LPPGFRFFPSDEELVVHFLYPKASLLPCHP-DIIPSLNLRHVDPWDLDGKALQGGNQWYFFSQRIQ--------NRVSPNGHWMPIGIDEPITS- 88 
                     79*************************999.99**************977778899******9855........89999***************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++++vg+kktLvfy g+ap g+kt+Wvm ey+l
  XP_010911499.1  89 SNKVVGMKKTLVFYIGEAPCGVKTNWVMLEYHL 121
                     8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-483155IPR003441NAC domain
PROSITE profilePS5100543.5974157IPR003441NAC domain
PfamPF023653.4E-215121IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010089Biological Processxylem development
GO:0043067Biological Processregulation of programmed cell death
GO:0048367Biological Processshoot system development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MGGLPPGFRF FPSDEELVVH FLYPKASLLP CHPDIIPSLN LRHVDPWDLD GKALQGGNQW  60
YFFSQRIQNR VSPNGHWMPI GIDEPITSSN KVVGMKKTLV FYIGEAPCGV KTNWVMLEYH  120
LLDSSTNSSS SGNRSSKKRG HQRIVSDNWI ICRVYEASCD SVPSFLNDET ELSCLDEVFL  180
SLDDLDEISL PN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-39416117169NO APICAL MERISTEM PROTEIN
1ut4_B1e-39416117169NO APICAL MERISTEM PROTEIN
1ut7_A1e-39416117169NO APICAL MERISTEM PROTEIN
1ut7_B1e-39416117169NO APICAL MERISTEM PROTEIN
3swm_A9e-40416120172NAC domain-containing protein 19
3swm_B9e-40416120172NAC domain-containing protein 19
3swm_C9e-40416120172NAC domain-containing protein 19
3swm_D9e-40416120172NAC domain-containing protein 19
3swp_A9e-40416120172NAC domain-containing protein 19
3swp_B9e-40416120172NAC domain-containing protein 19
3swp_C9e-40416120172NAC domain-containing protein 19
3swp_D9e-40416120172NAC domain-containing protein 19
4dul_A1e-39416117169NAC domain-containing protein 19
4dul_B1e-39416117169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010911499.11e-142PREDICTED: NAC transcription factor NAM-1-like
SwissprotQ8GWK62e-69NC104_ARATH; NAC domain-containing protein 104
TrEMBLF6IAY63e-83F6IAY6_HORVD; NAC transcription factor
STRINGMLOC_15681.28e-83(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36673679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.12e-69xylem NAC domain 1